HSPA1L monoclonal antibody (M02), clone 7H6
  • HSPA1L monoclonal antibody (M02), clone 7H6

HSPA1L monoclonal antibody (M02), clone 7H6

Ref: AB-H00003305-M02
HSPA1L monoclonal antibody (M02), clone 7H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HSPA1L.
Información adicional
Size 100 ug
Gene Name HSPA1L
Gene Alias HSP70-1L|HSP70-HOM|HSP70T|hum70t
Gene Description heat shock 70kDa protein 1-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3305
Clone Number 7H6
Iso type IgG1 Kappa

Enviar un mensaje


HSPA1L monoclonal antibody (M02), clone 7H6

HSPA1L monoclonal antibody (M02), clone 7H6