HSF1 polyclonal antibody (A01)
  • HSF1 polyclonal antibody (A01)

HSF1 polyclonal antibody (A01)

Ref: AB-H00003297-A01
HSF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HSF1.
Información adicional
Size 50 uL
Gene Name HSF1
Gene Alias HSTF1
Gene Description heat shock transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSF1 (NP_005517, 420 a.a. ~ 529 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3297

Enviar un mensaje


HSF1 polyclonal antibody (A01)

HSF1 polyclonal antibody (A01)