HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)
  • HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)

HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003294-D01P
HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSD17B2 protein.
Información adicional
Size 100 ug
Gene Name HSD17B2
Gene Alias EDH17B2|HSD17|SDR9C2
Gene Description hydroxysteroid (17-beta) dehydrogenase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSD17B2 (NP_002144.1, 1 a.a. ~ 387 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3294

Enviar un mensaje


HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)

HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P)