HSD17B3 polyclonal antibody (A01)
  • HSD17B3 polyclonal antibody (A01)

HSD17B3 polyclonal antibody (A01)

Ref: AB-H00003293-A01
HSD17B3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HSD17B3.
Información adicional
Size 50 uL
Gene Name HSD17B3
Gene Alias EDH17B3|SDR12C2
Gene Description hydroxysteroid (17-beta) dehydrogenase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSD17B3 (NP_000188, 29 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3293

Enviar un mensaje


HSD17B3 polyclonal antibody (A01)

HSD17B3 polyclonal antibody (A01)