HES1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HES1 purified MaxPab rabbit polyclonal antibody (D01P)

HES1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003280-D01P
HES1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HES1 protein.
Información adicional
Size 100 ug
Gene Name HES1
Gene Alias FLJ20408|HES-1|HHL|HRY|bHLHb39
Gene Description hairy and enhancer of split 1, (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPADIMEKNSSSPVAASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HES1 (AAH39152.1, 1 a.a. ~ 277 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3280

Enviar un mensaje


HES1 purified MaxPab rabbit polyclonal antibody (D01P)

HES1 purified MaxPab rabbit polyclonal antibody (D01P)