PRMT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRMT2 purified MaxPab rabbit polyclonal antibody (D01P)

PRMT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003275-D01P
PRMT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRMT2 protein.
Información adicional
Size 100 ug
Gene Name PRMT2
Gene Alias HRMT1L1|MGC111373
Gene Description protein arginine methyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSAD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRMT2 (NP_001526.2, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3275

Enviar un mensaje


PRMT2 purified MaxPab rabbit polyclonal antibody (D01P)

PRMT2 purified MaxPab rabbit polyclonal antibody (D01P)