HRBL polyclonal antibody (A01)
  • HRBL polyclonal antibody (A01)

HRBL polyclonal antibody (A01)

Ref: AB-H00003268-A01
HRBL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HRBL.
Información adicional
Size 50 uL
Gene Name AGFG2
Gene Alias HRBL|RABR
Gene Description ArfGAP with FG repeats 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HRBL (NP_006067, 131 a.a. ~ 228 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3268

Enviar un mensaje


HRBL polyclonal antibody (A01)

HRBL polyclonal antibody (A01)