ERAS purified MaxPab mouse polyclonal antibody (B01P)
  • ERAS purified MaxPab mouse polyclonal antibody (B01P)

ERAS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003266-B01P
ERAS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ERAS protein.
Información adicional
Size 50 ug
Gene Name ERAS
Gene Alias HRAS2|HRASP|MGC126691|MGC126693
Gene Description ES cell expressed Ras
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ERAS (NP_853510.1, 1 a.a. ~ 233 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3266

Enviar un mensaje


ERAS purified MaxPab mouse polyclonal antibody (B01P)

ERAS purified MaxPab mouse polyclonal antibody (B01P)