HP purified MaxPab mouse polyclonal antibody (B01P)
  • HP purified MaxPab mouse polyclonal antibody (B01P)

HP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003240-B01P
HP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HP protein.
Información adicional
Size 50 ug
Gene Name HP
Gene Alias BP|HP2-ALPHA-2|HPA1S|MGC111141
Gene Description haptoglobin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRISQMTAARSPPRLHMAMWSTRFATSVRTNAVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HP (AAH70299.1, 1 a.a. ~ 281 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3240

Enviar un mensaje


HP purified MaxPab mouse polyclonal antibody (B01P)

HP purified MaxPab mouse polyclonal antibody (B01P)