HOXC8 purified MaxPab rabbit polyclonal antibody (D01P)
  • HOXC8 purified MaxPab rabbit polyclonal antibody (D01P)

HOXC8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003224-D01P
HOXC8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HOXC8 protein.
Información adicional
Size 100 ug
Gene Name HOXC8
Gene Alias HOX3|HOX3A
Gene Description homeobox C8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HOXC8 (NP_073149.1, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3224

Enviar un mensaje


HOXC8 purified MaxPab rabbit polyclonal antibody (D01P)

HOXC8 purified MaxPab rabbit polyclonal antibody (D01P)