HOXC4 purified MaxPab rabbit polyclonal antibody (D01P)
  • HOXC4 purified MaxPab rabbit polyclonal antibody (D01P)

HOXC4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003221-D01P
HOXC4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HOXC4 protein.
Información adicional
Size 100 ug
Gene Name HOXC4
Gene Alias HOX3|HOX3E|cp19
Gene Description homeobox C4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HOXC4 (NP_055435.2, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3221

Enviar un mensaje


HOXC4 purified MaxPab rabbit polyclonal antibody (D01P)

HOXC4 purified MaxPab rabbit polyclonal antibody (D01P)