HOXB9 monoclonal antibody (M01), clone 3C8
  • HOXB9 monoclonal antibody (M01), clone 3C8

HOXB9 monoclonal antibody (M01), clone 3C8

Ref: AB-H00003219-M01
HOXB9 monoclonal antibody (M01), clone 3C8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant HOXB9.
Información adicional
Size 100 ug
Gene Name HOXB9
Gene Alias HOX-2.5|HOX2|HOX2E
Gene Description homeobox B9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3219
Clone Number 3C8
Iso type IgG2a Kappa

Enviar un mensaje


HOXB9 monoclonal antibody (M01), clone 3C8

HOXB9 monoclonal antibody (M01), clone 3C8