HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)
  • HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)

HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)

Ref: AB-H00003219-D03P
HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HOXB9 protein.
Información adicional
Size 100 ug
Gene Name HOXB9
Gene Alias HOX-2.5|HOX2|HOX2E
Gene Description homeobox B9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HOXB9 (NP_076922.1, 1 a.a. ~ 250 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3219

Enviar un mensaje


HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)

HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)