HOXA5 polyclonal antibody (A01)
  • HOXA5 polyclonal antibody (A01)

HOXA5 polyclonal antibody (A01)

Ref: AB-H00003202-A01
HOXA5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HOXA5.
Información adicional
Size 50 uL
Gene Name HOXA5
Gene Alias HOX1|HOX1.3|HOX1C|MGC9376
Gene Description homeobox A5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HOXA5 (NP_061975.1, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3202

Enviar un mensaje


HOXA5 polyclonal antibody (A01)

HOXA5 polyclonal antibody (A01)