HOXA3 polyclonal antibody (A01)
  • HOXA3 polyclonal antibody (A01)

HOXA3 polyclonal antibody (A01)

Ref: AB-H00003200-A01
HOXA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HOXA3.
Información adicional
Size 50 uL
Gene Name HOXA3
Gene Alias HOX1|HOX1E|MGC10155
Gene Description homeobox A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HOXA3 (NP_705895, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3200

Enviar un mensaje


HOXA3 polyclonal antibody (A01)

HOXA3 polyclonal antibody (A01)