HNRNPA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HNRNPA1 purified MaxPab rabbit polyclonal antibody (D01P)

HNRNPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003178-D01P
HNRNPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HNRNPA1 protein.
Información adicional
Size 100 ug
Gene Name HNRNPA1
Gene Alias HNRPA1|MGC102835
Gene Description heterogeneous nuclear ribonucleoprotein A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HNRNPA1 (NP_002127.1, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3178

Enviar un mensaje


HNRNPA1 purified MaxPab rabbit polyclonal antibody (D01P)

HNRNPA1 purified MaxPab rabbit polyclonal antibody (D01P)