Ver mas grande
HNF4A monoclonal antibody (M05), clone 1F12
AB-H00003172-M05
Producto nuevo
HNF4A monoclonal antibody (M05), clone 1F12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | HNF4A |
| Gene Alias | FLJ39654|HNF4|HNF4a7|HNF4a8|HNF4a9|MODY|MODY1|NR2A1|NR2A21|TCF|TCF14 |
| Gene Description | hepatocyte nuclear factor 4, alpha |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA,IF |
| Immunogen Prot. Seq | NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3172 |
| Clone Number | 1F12 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant HNF4A.