HLA-DOB purified MaxPab mouse polyclonal antibody (B01P)
  • HLA-DOB purified MaxPab mouse polyclonal antibody (B01P)

HLA-DOB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003112-B01P
HLA-DOB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HLA-DOB protein.
Información adicional
Size 50 ug
Gene Name HLA-DOB
Gene Alias DOB
Gene Description major histocompatibility complex, class II, DO beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-DOB (NP_002111.1, 1 a.a. ~ 273 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3112

Enviar un mensaje


HLA-DOB purified MaxPab mouse polyclonal antibody (B01P)

HLA-DOB purified MaxPab mouse polyclonal antibody (B01P)