HLA-DOB polyclonal antibody (A01)
  • HLA-DOB polyclonal antibody (A01)

HLA-DOB polyclonal antibody (A01)

Ref: AB-H00003112-A01
HLA-DOB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HLA-DOB.
Información adicional
Size 50 uL
Gene Name HLA-DOB
Gene Alias DOB
Gene Description major histocompatibility complex, class II, DO beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HLA-DOB (NP_002111, 27 a.a. ~ 116 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3112

Enviar un mensaje


HLA-DOB polyclonal antibody (A01)

HLA-DOB polyclonal antibody (A01)