HLA-DMB purified MaxPab rabbit polyclonal antibody (D01P)
  • HLA-DMB purified MaxPab rabbit polyclonal antibody (D01P)

HLA-DMB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003109-D01P
HLA-DMB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HLA-DMB protein.
Información adicional
Size 100 ug
Gene Name HLA-DMB
Gene Alias D6S221E|RING7
Gene Description major histocompatibility complex, class II, DM beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-DMB (NP_002109.1, 1 a.a. ~ 263 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3109

Enviar un mensaje


HLA-DMB purified MaxPab rabbit polyclonal antibody (D01P)

HLA-DMB purified MaxPab rabbit polyclonal antibody (D01P)