HLA-A purified MaxPab rabbit polyclonal antibody (D01P)
  • HLA-A purified MaxPab rabbit polyclonal antibody (D01P)

HLA-A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003105-D01P
HLA-A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HLA-A protein.
Información adicional
Size 100 ug
Gene Name HLA-A
Gene Alias HLAA
Gene Description major histocompatibility complex, class I, A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HLA-A (NP_002107.3, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3105

Enviar un mensaje


HLA-A purified MaxPab rabbit polyclonal antibody (D01P)

HLA-A purified MaxPab rabbit polyclonal antibody (D01P)