HK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • HK3 purified MaxPab rabbit polyclonal antibody (D01P)

HK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003101-D01P
HK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HK3 protein.
Información adicional
Size 100 ug
Gene Name HK3
Gene Alias HKIII|HXK3
Gene Description hexokinase 3 (white cell)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HK3 (AAH28129.1, 1 a.a. ~ 923 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3101

Enviar un mensaje


HK3 purified MaxPab rabbit polyclonal antibody (D01P)

HK3 purified MaxPab rabbit polyclonal antibody (D01P)