HK2 monoclonal antibody (M01), clone 4H1
  • HK2 monoclonal antibody (M01), clone 4H1

HK2 monoclonal antibody (M01), clone 4H1

Ref: AB-H00003099-M01
HK2 monoclonal antibody (M01), clone 4H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HK2.
Información adicional
Size 100 ug
Gene Name HK2
Gene Alias DKFZp686M1669|HKII|HXK2
Gene Description hexokinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HK2 (AAH21116, 818 a.a. ~ 917 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3099
Clone Number 4H1
Iso type IgG2a Kappa

Enviar un mensaje


HK2 monoclonal antibody (M01), clone 4H1

HK2 monoclonal antibody (M01), clone 4H1