HK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HK1 purified MaxPab rabbit polyclonal antibody (D01P)

HK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003098-D01P
HK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HK1 protein.
Información adicional
Size 100 ug
Gene Name HK1
Gene Alias HK1-ta|HK1-tb|HK1-tc|HKI|HXK1
Gene Description hexokinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MDCEHSLSLPCRGAEAWEIGIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HK1 (NP_277031.1, 1 a.a. ~ 916 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3098

Enviar un mensaje


HK1 purified MaxPab rabbit polyclonal antibody (D01P)

HK1 purified MaxPab rabbit polyclonal antibody (D01P)