HK1 polyclonal antibody (A01)
  • HK1 polyclonal antibody (A01)

HK1 polyclonal antibody (A01)

Ref: AB-H00003098-A01
HK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HK1.
Información adicional
Size 50 uL
Gene Name HK1
Gene Alias HK1-ta|HK1-tb|HK1-tc|HKI|HXK1
Gene Description hexokinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HK1 (NP_277031, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3098

Enviar un mensaje


HK1 polyclonal antibody (A01)

HK1 polyclonal antibody (A01)