HINT1 purified MaxPab mouse polyclonal antibody (B01P)
  • HINT1 purified MaxPab mouse polyclonal antibody (B01P)

HINT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003094-B01P
HINT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HINT1 protein.
Información adicional
Size 50 ug
Gene Name HINT1
Gene Alias FLJ30414|FLJ32340|HINT|PKCI-1|PRKCNH1
Gene Description histidine triad nucleotide binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HINT1 (NP_005331.1, 1 a.a. ~ 126 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3094

Enviar un mensaje


HINT1 purified MaxPab mouse polyclonal antibody (B01P)

HINT1 purified MaxPab mouse polyclonal antibody (B01P)