HINT1 polyclonal antibody (A01)
  • HINT1 polyclonal antibody (A01)

HINT1 polyclonal antibody (A01)

Ref: AB-H00003094-A01
HINT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HINT1.
Información adicional
Size 50 uL
Gene Name HINT1
Gene Alias FLJ30414|FLJ32340|HINT|PKCI-1|PRKCNH1
Gene Description histidine triad nucleotide binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HINT1 (NP_005331, 59 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3094

Enviar un mensaje


HINT1 polyclonal antibody (A01)

HINT1 polyclonal antibody (A01)