HIP1 monoclonal antibody (M02), clone 1E9
  • HIP1 monoclonal antibody (M02), clone 1E9

HIP1 monoclonal antibody (M02), clone 1E9

Ref: AB-H00003092-M02
HIP1 monoclonal antibody (M02), clone 1E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIP1.
Información adicional
Size 100 ug
Gene Name HIP1
Gene Alias ILWEQ|MGC126506
Gene Description huntingtin interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIP1 (NP_005329, 928 a.a. ~ 1037 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3092
Clone Number 1E9
Iso type IgG2a Kappa

Enviar un mensaje


HIP1 monoclonal antibody (M02), clone 1E9

HIP1 monoclonal antibody (M02), clone 1E9