HIP1 polyclonal antibody (A01)
  • HIP1 polyclonal antibody (A01)

HIP1 polyclonal antibody (A01)

Ref: AB-H00003092-A01
HIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HIP1.
Información adicional
Size 50 uL
Gene Name HIP1
Gene Alias ILWEQ|MGC126506
Gene Description huntingtin interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIP1 (NP_005329, 928 a.a. ~ 1037 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3092

Enviar un mensaje


HIP1 polyclonal antibody (A01)

HIP1 polyclonal antibody (A01)