HIF1A monoclonal antibody (M04), clone 2E23
  • HIF1A monoclonal antibody (M04), clone 2E23

HIF1A monoclonal antibody (M04), clone 2E23

Ref: AB-H00003091-M04
HIF1A monoclonal antibody (M04), clone 2E23

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIF1A.
Información adicional
Size 100 ug
Gene Name HIF1A
Gene Alias HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78
Gene Description hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3091
Clone Number 2E23
Iso type IgG2b Kappa

Enviar un mensaje


HIF1A monoclonal antibody (M04), clone 2E23

HIF1A monoclonal antibody (M04), clone 2E23