HIF1A monoclonal antibody (M02), clone 1D4
  • HIF1A monoclonal antibody (M02), clone 1D4

HIF1A monoclonal antibody (M02), clone 1D4

Ref: AB-H00003091-M02
HIF1A monoclonal antibody (M02), clone 1D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIF1A.
Información adicional
Size 100 ug
Gene Name HIF1A
Gene Alias HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78
Gene Description hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3091
Clone Number 1D4
Iso type IgG2b Kappa

Enviar un mensaje


HIF1A monoclonal antibody (M02), clone 1D4

HIF1A monoclonal antibody (M02), clone 1D4