HIF1A polyclonal antibody (A01)
  • HIF1A polyclonal antibody (A01)

HIF1A polyclonal antibody (A01)

Ref: AB-H00003091-A01
HIF1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HIF1A.
Información adicional
Size 50 uL
Gene Name HIF1A
Gene Alias HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78
Gene Description hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3091

Enviar un mensaje


HIF1A polyclonal antibody (A01)

HIF1A polyclonal antibody (A01)