HIC1 monoclonal antibody (M12), clone 2B9
  • HIC1 monoclonal antibody (M12), clone 2B9

HIC1 monoclonal antibody (M12), clone 2B9

Ref: AB-H00003090-M12
HIC1 monoclonal antibody (M12), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIC1.
Información adicional
Size 100 ug
Gene Name HIC1
Gene Alias ZBTB29|hic-1
Gene Description hypermethylated in cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIC1 (NP_006488.2, 627 a.a. ~ 705 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3090
Clone Number 2B9
Iso type IgG2a Kappa

Enviar un mensaje


HIC1 monoclonal antibody (M12), clone 2B9

HIC1 monoclonal antibody (M12), clone 2B9