HIC1 monoclonal antibody (M05), clone 1F2
  • HIC1 monoclonal antibody (M05), clone 1F2

HIC1 monoclonal antibody (M05), clone 1F2

Ref: AB-H00003090-M05
HIC1 monoclonal antibody (M05), clone 1F2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HIC1.
Información adicional
Size 100 ug
Gene Name HIC1
Gene Alias ZBTB29|hic-1
Gene Description hypermethylated in cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIC1 (NP_006488.2, 627 a.a. ~ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3090
Clone Number 1F2
Iso type IgG2a Kappa

Enviar un mensaje


HIC1 monoclonal antibody (M05), clone 1F2

HIC1 monoclonal antibody (M05), clone 1F2