Ver mas grande
HIC1 monoclonal antibody (M05), clone 1F2
AB-H00003090-M05
Producto nuevo
HIC1 monoclonal antibody (M05), clone 1F2
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | HIC1 |
| Gene Alias | ZBTB29|hic-1 |
| Gene Description | hypermethylated in cancer 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | HIC1 (NP_006488.2, 627 a.a. ~ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3090 |
| Clone Number | 1F2 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant HIC1.