HGD purified MaxPab mouse polyclonal antibody (B01P)
  • HGD purified MaxPab mouse polyclonal antibody (B01P)

HGD purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003081-B01P
HGD purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HGD protein.
Información adicional
Size 50 ug
Gene Name HGD
Gene Alias AKU|HGO
Gene Description homogentisate 1,2-dioxygenase (homogentisate oxidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HGD (AAH71757.1, 1 a.a. ~ 445 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3081

Enviar un mensaje


HGD purified MaxPab mouse polyclonal antibody (B01P)

HGD purified MaxPab mouse polyclonal antibody (B01P)