HFE monoclonal antibody (M01), clone 1G12
  • HFE monoclonal antibody (M01), clone 1G12

HFE monoclonal antibody (M01), clone 1G12

Ref: AB-H00003077-M01
HFE monoclonal antibody (M01), clone 1G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HFE.
Información adicional
Size 100 ug
Gene Name HFE
Gene Alias HFE1|HH|HLA-H|MGC103790|dJ221C16.10.1
Gene Description hemochromatosis
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HFE (NP_000401, 115 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3077
Clone Number 1G12
Iso type IgG1 Kappa

Enviar un mensaje


HFE monoclonal antibody (M01), clone 1G12

HFE monoclonal antibody (M01), clone 1G12