HFE purified MaxPab mouse polyclonal antibody (B01P) Ver mas grande

HFE purified MaxPab mouse polyclonal antibody (B01P)

AB-H00003077-B01P

Producto nuevo

HFE purified MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name HFE
Gene Alias HFE1|HH|HLA-H|MGC103790|dJ221C16.10.1
Gene Description hemochromatosis
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Ce,WB-Tr
Immunogen Prot. Seq MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HFE (NP_000401.1, 1 a.a. ~ 348 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3077

Más información

Mouse polyclonal antibody raised against a full-length human HFE protein.

Consulta sobre un producto

HFE purified MaxPab mouse polyclonal antibody (B01P)

HFE purified MaxPab mouse polyclonal antibody (B01P)