HDGF monoclonal antibody (M09), clone 2D6
  • HDGF monoclonal antibody (M09), clone 2D6

HDGF monoclonal antibody (M09), clone 2D6

Ref: AB-H00003068-M09
HDGF monoclonal antibody (M09), clone 2D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HDGF.
Información adicional
Size 100 ug
Gene Name HDGF
Gene Alias DKFZp686J1764|FLJ96580|HMG1L2
Gene Description hepatoma-derived growth factor (high-mobility group protein 1-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HDGF (NP_004485, 184 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3068
Clone Number 2D6
Iso type IgG2a Kappa

Enviar un mensaje


HDGF monoclonal antibody (M09), clone 2D6

HDGF monoclonal antibody (M09), clone 2D6