HDAC2 purified MaxPab rabbit polyclonal antibody (D01P)
  • HDAC2 purified MaxPab rabbit polyclonal antibody (D01P)

HDAC2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003066-D01P
HDAC2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HDAC2 protein.
Información adicional
Size 100 ug
Gene Name HDAC2
Gene Alias RPD3|YAF1
Gene Description histone deacetylase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce,IF
Immunogen Prot. Seq MRSPPCGLLRWFGGPLLASWCRCHLRFRAFGTSAGWYRAFPAPPPLLPPACPSPRDYRPHVSLSPFLSRPSRGGSSSSSSSRRRSPVAAVAGEPMAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HDAC2 (AAI48798.1, 1 a.a. ~ 582 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3066

Enviar un mensaje


HDAC2 purified MaxPab rabbit polyclonal antibody (D01P)

HDAC2 purified MaxPab rabbit polyclonal antibody (D01P)