Ver mas grande
HDAC1 monoclonal antibody (M14), clone 5C11
AB-H00003065-M14
Producto nuevo
HDAC1 monoclonal antibody (M14), clone 5C11
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | HDAC1 |
| Gene Alias | DKFZp686H12203|GON-10|HD1|RPD3|RPD3L1 |
| Gene Description | histone deacetylase 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,PLA-Ce,IF |
| Immunogen Prot. Seq | MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | HDAC1 (AAH00301, 1 a.a. ~ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3065 |
| Clone Number | 5C11 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant HDAC1.