HDAC1 MaxPab rabbit polyclonal antibody (D01)
  • HDAC1 MaxPab rabbit polyclonal antibody (D01)

HDAC1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003065-D01
HDAC1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HDAC1 protein.
Información adicional
Size 100 uL
Gene Name HDAC1
Gene Alias DKFZp686H12203|GON-10|HD1|RPD3|RPD3L1
Gene Description histone deacetylase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HDAC1 (NP_004955.2, 1 a.a. ~ 482 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3065

Enviar un mensaje


HDAC1 MaxPab rabbit polyclonal antibody (D01)

HDAC1 MaxPab rabbit polyclonal antibody (D01)