HCRTR2 monoclonal antibody (M01), clone 1E3
  • HCRTR2 monoclonal antibody (M01), clone 1E3

HCRTR2 monoclonal antibody (M01), clone 1E3

Ref: AB-H00003062-M01
HCRTR2 monoclonal antibody (M01), clone 1E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HCRTR2.
Información adicional
Size 100 ug
Gene Name HCRTR2
Gene Alias OX2R
Gene Description hypocretin (orexin) receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HCRTR2 (NP_001517, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3062
Clone Number 1E3
Iso type IgG1 Kappa

Enviar un mensaje


HCRTR2 monoclonal antibody (M01), clone 1E3

HCRTR2 monoclonal antibody (M01), clone 1E3