HCRTR2 MaxPab mouse polyclonal antibody (B01P)
  • HCRTR2 MaxPab mouse polyclonal antibody (B01P)

HCRTR2 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003062-B01P
HCRTR2 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HCRTR2 protein.
Información adicional
Size 50 ug
Gene Name HCRTR2
Gene Alias OX2R
Gene Description hypocretin (orexin) receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HCRTR2 (NP_001517, 1 a.a. ~ 444 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3062

Enviar un mensaje


HCRTR2 MaxPab mouse polyclonal antibody (B01P)

HCRTR2 MaxPab mouse polyclonal antibody (B01P)