HCLS1 MaxPab rabbit polyclonal antibody (D01)
  • HCLS1 MaxPab rabbit polyclonal antibody (D01)

HCLS1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003059-D01
HCLS1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HCLS1 protein.
Información adicional
Size 100 uL
Gene Name HCLS1
Gene Alias CTTNL|HS1
Gene Description hematopoietic cell-specific Lyn substrate 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HCLS1 (NP_005326.1, 1 a.a. ~ 486 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3059

Enviar un mensaje


HCLS1 MaxPab rabbit polyclonal antibody (D01)

HCLS1 MaxPab rabbit polyclonal antibody (D01)