HBZ purified MaxPab rabbit polyclonal antibody (D01P)
  • HBZ purified MaxPab rabbit polyclonal antibody (D01P)

HBZ purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003050-D01P
HBZ purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HBZ protein.
Información adicional
Size 100 ug
Gene Name HBZ
Gene Alias -
Gene Description hemoglobin, zeta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HBZ (NP_005323.1, 1 a.a. ~ 142 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3050

Enviar un mensaje


HBZ purified MaxPab rabbit polyclonal antibody (D01P)

HBZ purified MaxPab rabbit polyclonal antibody (D01P)