HBQ1 polyclonal antibody (A01)
  • HBQ1 polyclonal antibody (A01)

HBQ1 polyclonal antibody (A01)

Ref: AB-H00003049-A01
HBQ1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HBQ1.
Información adicional
Size 50 uL
Gene Name HBQ1
Gene Alias -
Gene Description hemoglobin, theta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HBQ1 (NP_005322, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3049

Enviar un mensaje


HBQ1 polyclonal antibody (A01)

HBQ1 polyclonal antibody (A01)