HBB polyclonal antibody (A01)
  • HBB polyclonal antibody (A01)

HBB polyclonal antibody (A01)

Ref: AB-H00003043-A01
HBB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HBB.
Información adicional
Size 50 uL
Gene Name HBB
Gene Alias CD113t-C
Gene Description hemoglobin, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3043

Enviar un mensaje


HBB polyclonal antibody (A01)

HBB polyclonal antibody (A01)