HARS MaxPab rabbit polyclonal antibody (D01)
  • HARS MaxPab rabbit polyclonal antibody (D01)

HARS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003035-D01
HARS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HARS protein.
Información adicional
Size 100 uL
Gene Name HARS
Gene Alias FLJ20491|HRS
Gene Description histidyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HARS (NP_002100.2, 1 a.a. ~ 509 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3035

Enviar un mensaje


HARS MaxPab rabbit polyclonal antibody (D01)

HARS MaxPab rabbit polyclonal antibody (D01)