HARS purified MaxPab mouse polyclonal antibody (B01P)
  • HARS purified MaxPab mouse polyclonal antibody (B01P)

HARS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003035-B01P
HARS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HARS protein.
Información adicional
Size 50 ug
Gene Name HARS
Gene Alias FLJ20491|HRS
Gene Description histidyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HARS (NP_002100.2, 1 a.a. ~ 509 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3035

Enviar un mensaje


HARS purified MaxPab mouse polyclonal antibody (B01P)

HARS purified MaxPab mouse polyclonal antibody (B01P)