HAL monoclonal antibody (M04), clone 4F2
  • HAL monoclonal antibody (M04), clone 4F2

HAL monoclonal antibody (M04), clone 4F2

Ref: AB-H00003034-M04
HAL monoclonal antibody (M04), clone 4F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HAL.
Información adicional
Size 100 ug
Gene Name HAL
Gene Alias HIS|HSTD
Gene Description histidine ammonia-lyase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HAL (NP_002099, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3034
Clone Number 4F2
Iso type IgG2a Kappa

Enviar un mensaje


HAL monoclonal antibody (M04), clone 4F2

HAL monoclonal antibody (M04), clone 4F2